PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610440.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 340aa    MW: 37921.9 Da    PI: 7.1318
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610440.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.62.2e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd +l d+++++G+g +W + + + g++R++k+c++rw++yl
   XP_013610440.1 14 RGPWSPEEDAKLRDYIEKYGNGgNWISLPLKAGLRRCGKSCRLRWLNYL 62
                     89*********************************************97 PP

2Myb_DNA-binding40.66.1e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +++  G++ W+ Ia++++ gRt++++k++w++
   XP_013610440.1  69 GDFSEEEDRIIFSLFAAIGSR-WSIIAAHLQ-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.374962IPR017930Myb domain
SuperFamilySSF466893.08E-2712109IPR009057Homeodomain-like
SMARTSM007179.0E-121364IPR001005SANT/Myb domain
PfamPF002494.4E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.8E-241569IPR009057Homeodomain-like
CDDcd001674.19E-91662No hitNo description
PROSITE profilePS5129423.25663117IPR017930Myb domain
SMARTSM007171.1E-1267115IPR001005SANT/Myb domain
PfamPF002495.5E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.7E-2370117IPR009057Homeodomain-like
CDDcd001672.69E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MGRAPCCDKT KVKRGPWSPE EDAKLRDYIE KYGNGGNWIS LPLKAGLRRC GKSCRLRWLN  60
YLRPNIKHGD FSEEEDRIIF SLFAAIGSRW SIIAAHLQGR TDNDIKNYWN TKLRKKIMSS  120
SSSSSSSHSS AAMATPFLNP NSHDVKRPIT PSATIAPFSY NPYVENSTRS LISNINGFEA  180
DDQQIFPFFN PNYPHEFSLE DMSSSNNNNN ISGTSGFLLN HSMCDHYSNH NNFSSEVNGK  240
RSEIMMEQEE MMMIDHHIDQ MTEGYNGDFT QGYYNNDING HGDLKRMISG TGTNSNINMG  300
GSGSGSGSGT ASSSSFISNL AENKTSSSLL QHTCLPYFYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-27141177108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610440.10.0PREDICTED: transcription factor RAX1-like
SwissprotQ9FG681e-161RAX1_ARATH; Transcription factor RAX1
TrEMBLA0A0D3ED950.0A0A0D3ED95_BRAOL; Uncharacterized protein
STRINGBra002448.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM140131623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23000.11e-143myb domain protein 37